BAFF R Protein

CAT:
247-OPPA00688-10UG
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BAFF R Protein - image 1

BAFF R Protein

  • Gene Aliases:

    BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin
  • Gene ID:

    115650
  • Accession Number:

    NP_443177.1
  • Reactivity:

    Human
  • Target:

    Recombinant Human BAFF (BLyS) Receptor
  • Type:

    Protein
  • Sequence:

    MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
  • Reconstitution:

    Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
  • Notes:

    Formerly GWB-5FA36E
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    BAFF R
  • Host or Source:

    E. Coli
  • Protein Name:

    Tumor necrosis factor receptor superfamily member 13C
  • Gene Name URL:

    BAFF R