DNAJC19 Recombinant Protein (Human)

CAT:
247-OPCA05015-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DNAJC19 Recombinant Protein (Human) - image 1

DNAJC19 Recombinant Protein (Human)

  • CAS Number :

    9000-83-3
  • Gene Name :

    DnaJ heat shock protein family (Hsp40) member C19
  • Gene Aliases :

    DnaJ (Hsp40) homolog, subfamily C, member 19; DnaJ homolog subfamily C member 19; DnaJ-like protein subfamily C member 19; homolog of yeast TIM14; mitochondrial import inner membrane translocase subunit TIM14; PAM18; TIM14; TIMM14.
  • Gene ID :

    131118
  • Accession Number :

    NP_001177162
  • Reactivity :

    Homo sapiens|Human
  • Target :

    Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity) .
  • Type :

    Protein
  • Source :

    E.coli
  • Sequence :

    MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    39.5 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    DNAJC19
  • Protein Name :

    Mitochondrial import inner membrane translocase subunit TIM14
  • Gene Name URL :

    DNAJC19
  • Nucleotide Accession Number :

    NM_001190233

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide