DNAJC19 Recombinant Protein (Human)

CAT:
247-OPCA05015-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DNAJC19 Recombinant Protein (Human) - image 1

DNAJC19 Recombinant Protein (Human)

  • Gene Name:

    DnaJ heat shock protein family (Hsp40) member C19
  • Gene Aliases:

    DnaJ (Hsp40) homolog, subfamily C, member 19; DnaJ homolog subfamily C member 19; DnaJ-like protein subfamily C member 19; homolog of yeast TIM14; mitochondrial import inner membrane translocase subunit TIM14; PAM18; TIM14; TIMM14.
  • Gene ID:

    131118
  • Accession Number:

    NP_001177162
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity) .
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    39.5 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    DNAJC19
  • Protein Name:

    Mitochondrial import inner membrane translocase subunit TIM14
  • Gene Name URL:

    DNAJC19
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001190233