DNAJC19 Recombinant Protein (Human)

• Gene Name :

  DnaJ heat shock protein family (Hsp40) member C19

• Gene Aliases :

  DnaJ (Hsp40) homolog, subfamily C, member 19; DnaJ homolog subfamily C member 19; DnaJ-like protein subfamily C member 19; homolog of yeast TIM14; mitochondrial import inner membrane translocase subunit TIM14; PAM18; TIM14; TIMM14.

• Gene ID :

  131118

• Accession Number :

  NP_001177162

• Reactivity :

  Homo sapiens|Human

• Target :

  Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity) .

• Type :

  Protein

• Source :

  E.coli

• Sequence :

  MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  -20°C or -80°C

• Molecular Weight :

  39.5 kDa

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  DNAJC19

• Protein Name :

  Mitochondrial import inner membrane translocase subunit TIM14

• Gene Name URL :

  DNAJC19

• CAS Number :

  9000-83-3

• Nucleotide Accession Number :

  NM_001190233