MUP6 Recombinant Protein (Mouse)

CAT:
247-OPCA04199-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MUP6 Recombinant Protein (Mouse) - image 1

MUP6 Recombinant Protein (Mouse)

  • Gene Name:

    Major urinary protein 16|major urinary protein 19|major urinary protein 9
  • Gene Aliases:

    100039247; Alpha-2U-globulin; Gm12552; Gm14076; Group 1, BS6; major urinary protein 11; major urinary protein 14; major urinary protein 16; major urinary protein 17; major urinary protein 2; major urinary protein 2-like; Major urinary protein 6; Major urinary proteins 11 and 8; MUP 6; Mup11; MUP11 and MUP8; Mup14; Mup17; Mup2; Mup6; Mup8.
  • Gene ID:

    100038948|100039177|100189605
  • Accession Number:

    NP_001128599
  • Reactivity:

    Mouse|Mus musculus
  • Target:

    Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    34.7 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    Mup16|Mup19|Mup9
  • Protein Name:

    Major urinary protein 6
  • Gene Name URL:

    Mup16|Mup19|Mup9
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001135127