MUP6 Recombinant Protein (Mouse)

• Gene Name:

  Major urinary protein 16|major urinary protein 19|major urinary protein 9

• Gene Aliases:

  100039247; Alpha-2U-globulin; Gm12552; Gm14076; Group 1, BS6; major urinary protein 11; major urinary protein 14; major urinary protein 16; major urinary protein 17; major urinary protein 2; major urinary protein 2-like; Major urinary protein 6; Major urinary proteins 11 and 8; MUP 6; Mup11; MUP11 and MUP8; Mup14; Mup17; Mup2; Mup6; Mup8.

• Gene ID:

  100038948|100039177|100189605

• Accession Number:

  NP_001128599

• Reactivity:

  Mouse|Mus musculus

• Target:

  Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  34.7 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Mup16|Mup19|Mup9

• Protein Name:

  Major urinary protein 6

• Gene Name URL:

  Mup16|Mup19|Mup9

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001135127