DUSP26 Recombinant Protein

CAT:
247-OPCA02463-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DUSP26 Recombinant Protein - image 1

DUSP26 Recombinant Protein

  • Gene Name:

    Dual specificity phosphatase 26
  • Gene Aliases:

    DSP-4; dual specificity phosphatase 26 (putative) ; dual specificity phosphatase SKRP3; dual specificity protein phosphatase 26; DUSP24; LDP4; LDP-4; low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; mitogen-activated protein kinase phosphatase 8; MKP8; MKP-8; NATA1; NEAP; neuroendocrine-associated phosphatase; Novel amplified gene in thyroid anaplastic cancer; SKRP3.
  • Gene ID:

    78986
  • Accession Number:

    NP_001292044.1
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK) .
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    39.9 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    DUSP26
  • Host or Source:

    Human
  • Protein Name:

    Dual specificity protein phosphatase 26
  • Gene Name URL:

    DUSP26
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001305115.1