DUSP26 Recombinant Protein

• Gene Name:

  Dual specificity phosphatase 26

• Gene Aliases:

  DSP-4; dual specificity phosphatase 26 (putative) ; dual specificity phosphatase SKRP3; dual specificity protein phosphatase 26; DUSP24; LDP4; LDP-4; low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; mitogen-activated protein kinase phosphatase 8; MKP8; MKP-8; NATA1; NEAP; neuroendocrine-associated phosphatase; Novel amplified gene in thyroid anaplastic cancer; SKRP3.

• Gene ID:

  78986

• Accession Number:

  NP_001292044.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  39.9 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  DUSP26

• Host or Source:

  Human

• Protein Name:

  Dual specificity protein phosphatase 26

• Gene Name URL:

  DUSP26

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001305115.1