CREB3 Antibody

CAT:
247-OAAN03577-200UL
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CREB3 Antibody - image 1

CREB3 Antibody

  • Gene Name :

    CAMP responsive element binding protein 3
  • Gene Aliases :

    LZIP, LUMAN, sLZIP
  • Gene ID :

    10488
  • Swiss Prot :

    O43889
  • Accession Number :

    NP_006359.3
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human CREB3 (NP_006359.3) .
  • Target :

    This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTC
  • Applications :

    WB, IF
  • Purification :

    Affinity purification
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid.// PBS with 0.01% thimerosal, 50% glycerol, pH 7.3
  • Reconstitution :

    Store at -20° C. Avoid freeze/thaw cycles.
  • Molecular Weight :

    41 kDa
  • Fragment :

    IgG
  • NCBI Gene Symbol :

    CREB3
  • Host or Source :

    Rabbit
  • Protein Name :

    Cyclic AMP-responsive element-binding protein 3
  • Gene Name URL :

    CREB3
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    NM_006368.4

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide