MAPRE1 Antibody

• Gene Name:

  Microtubule associated protein RP/EB family member 1

• Gene Aliases:

  EB1

• Gene ID:

  22919

• Swiss Prot:

  Q15691

• Accession Number:

  NP_036457.1

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1) .

• Target:

  The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  ETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

• Applications:

  WB, IF

• Purification:

  Affinity purification

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid// PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)

• Reconstitution:

  Store at -20C. Avoid freeze/thaw cycles.

• Molecular Weight:

  30 kDa

• Fragment:

  IgG

• NCBI Gene Symbol:

  MAPRE1

• Host or Source:

  Rabbit

• Protein Name:

  Ragulator complex protein LAMTOR5

• Gene Name URL:

  MAPRE1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_012325.2