PABPC4 Antibody

CAT:
247-OAAN01613-50UL
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PABPC4 Antibody - image 1

PABPC4 Antibody

  • Gene Name :

    Poly (A) binding protein cytoplasmic 4
  • Gene Aliases :

    APP1, APP-1, PABP4, iPABP
  • Gene ID :

    8761
  • Swiss Prot :

    Q13310
  • Accession Number :

    NP_001129125.1
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC4 (NP_003810.1) .
  • Target :

    Poly (A) -binding proteins (PABPs) bind to the poly (A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Clonality :

    Polyclonal
  • Conjugation :

    Unconjugated
  • Type :

    Polyclonal Antibody
  • Sequence :

    VTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMP
  • Applications :

    WB, IHC, IF
  • Purification :

    Affinity purified against immunogen
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid// PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
  • Buffer :

    PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Reconstitution :

    Store at -20° C. Avoid repeated freeze/thaw cycles.
  • Molecular Weight :

    71 kDa
  • Fragment :

    IgG
  • NCBI Gene Symbol :

    PABPC4
  • Host or Source :

    Rabbit
  • Protein Name :

    Polyadenylate-binding protein 4
  • Gene Name URL :

    PABPC4
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    NM_001135653.1

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide