EXO1 Antibody

9007-83-4

Exonuclease 1

Exonuclease 1; HEX1; hExoI; rad2 nuclease family member, homolog of S. cerevisiae exonuclease 1.

9156

https://www.ncbi.nlm.nih.gov/protein/AAH07491

Human, Mouse

EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. [provided by RefSeq

1H6

Monoclonal Antibody

ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ

Enzyme-linked immunosorbent assay|Western blot

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Liquid

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

IgG1 Kappa

EXO1

Mouse

Exonuclease 1 [Homo sapiens]|Homo sapiens exonuclease 1, mRNA (cDNA clone MGC:1908 IMAGE:2967734), complete cds

EXO1