BMP-3, Human

• Description :

  BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  BMP-3 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/bmp-3-protein-human.html

• Purity :

  98.00

• Smiles :

  QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

• Molecular Formula :

  651 (Gene_ID) P12645 (Q363-R472) (Accession)

• Molecular Weight :

  Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins