Recombinant Rat Complement C5 (C5)

• Product Name Alternative :

  C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment

• Abbreviation :

  Recombinant Rat C5 protein

• Gene Name :

  C5

• UniProt :

  P08650

• Expression Region :

  1-77aa

• Organism :

  Rattus norvegicus (Rat)

• Target Sequence :

  DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

• Tag :

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type :

  In Stock Protein

• Source :

  E.coli

• Field of Research :

  Immunology

• Relevance :

  Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

• Endotoxin :

  Not test

• Purity :

  Greater than 85% as determined by SDS-PAGE.

• Activity :

  Not Test

• Form :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight :

  14.0 kDa

• References & Citations :

  "Primary structure and functional characterization of rat C5a: an anaphylatoxin with unusually high potency." Cui L.-X., Carney D.F., Hugli T.E. Protein Sci. 3:1169-1177 (1994)

• Storage Conditions :

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length :

  Full Length