Recombinant Pig Complement C5a anaphylatoxin (C5)

CAT: 0399-CSB-YP003995PI-01Size: 20 µgDry Ice: NoHazardous: No
CAT#:0399-CSB-YP003995PI-01Size:20 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Product Name Alternative
C5; Complement C5a anaphylatoxin
Abbreviation
Recombinant Pig Complement C5a anaphylatoxin protein
Gene Name
C5
UniProt
P01032
Expression Region
1-74aa
Organism
Sus scrofa (Pig)
Target Sequence
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
Yeast
Field of Research
Others
Relevance
Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Molecular Weight
10.6 kDa
References & Citations
Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.Williamson M.P., Madison V.S.Biochemistry 29:2895-2905 (1990)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length

Related Products

CatalogName
CSB-EP003995RA-01Recombinant Rat Complement C5 (C5)
CSB-MP003995HU(A4)-01Recombinant Human Complement C5 (C5) (Active)
CSB-MP003995HU-01Recombinant Human Complement C5 (C5), partial
CSB-EP003995HU-01Recombinant Human Complement C5 (C5), partial
CSB-CF003996HUd7-01Recombinant Human C5a anaphylatoxin chemotactic receptor (C5AR1)
CSB-EQ027637PI-01Pig complement fragment 5a (C5a) ELISA kit
CSB-EP003996HU1-01Recombinant Human C5a anaphylatoxin chemotactic receptor (C5AR1), partial
CSB-CF868390HU-01Recombinant Human C5a anaphylatoxin chemotactic receptor 2 (C5AR2)
CSB-EP003996MO1-01Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial
CSB-EL003995MK-01Monkey complement C5 (C5) ELISA kit

Alternative Products

CatalogName
AP72465-01Recombinant Pig Complement C5a anaphylatoxin(C5)
MBS718062-01Recombinant Bovine Complement C5a anaphylatoxin (C5)
RPC24540-01Recombinant Pig Complement C5a anaphylatoxin (C5)
R1969pPig C5 / Complement C5a anaphylatoxin Recombinant Protein
R1969bBovine C5 / Complement C5a anaphylatoxin Recombinant Protein
303164C5a, CT (Anaphylatoxin C5a Analog, Anaphylatoxin C5a, C5, C5a, Complement C5, Complement Component C5, Complement Component C5a, CPAMD 4, CPAMD4)
303165C5a, NT (Anaphylatoxin C5a Analog, Anaphylatoxin C5a, C5, C5a, Complement C5, Complement Component C5, Complement Component C5a, CPAMD 4, CPAMD4)
AP9C112-01Recombinant Swine Complement C5a Anaphylatoxin (C5), N-His
MBS6460694-01C5a, NT (Anaphylatoxin C5a Analog, Anaphylatoxin C5a, C5, C5a, Complement C5, Complement Component C5, Complement Component C5a, CPAMD 4, CPAMD4) (AP)
MBS6460695-01C5a, NT (Anaphylatoxin C5a Analog, Anaphylatoxin C5a, C5, C5a, Complement C5, Complement Component C5, Complement Component C5a, CPAMD 4, CPAMD4) (APC)

Popular Products