Recombinant Rat Complement C5 (C5)

• Description :

  Recombinant Rat Complement C5 (C5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: C5. Target Synonyms: C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment. Accession Number: P08650. Expression Region: 1~77aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Rat Complement C5 (C5) is a purified Recombinant Protein.

• Accession Number :

  P08650

• Expression Region :

  1~77aa

• Host :

  E. coli

• Target :

  C5

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

• Field of Research :

  Immunology

• Endotoxin :

  Not Tested

• Purity :

  >85% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Full Length

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  14.0kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment

• Species :

  Rat (Rattus norvegicus)

• Protein Name :

  Recombinant Protein

• CAS Number :

  9000-83-3

• AA Sequence :

  DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR