Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS)

CAT:
399-CSB-EP669769SBAF-03
Size:
1 mg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS) - image 1

Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS)

  • Product Name Alternative:

    4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)
  • Abbreviation:

    Recombinant Streptococcus pyogenes serotype M28 acpS protein
  • Gene Name:

    AcpS
  • UniProt:

    Q48RM7
  • Expression Region:

    1-118aa
  • Organism:

    Streptococcus pyogenes serotype M28 (strain MGAS6180)
  • Target Sequence:

    MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
  • Molecular Weight:

    18.3 kDa
  • References & Citations:

    "Genome sequence of a serotype M28 strain of group A Streptococcus: potential new insights into puerperal sepsis and bacterial disease specificity." Green N.M., Zhang S., Porcella S.F., Nagiec M.J., Barbian K.D., Beres S.B., Lefebvre R.B., Musser J.M. J. Infect. Dis. 192:760-770 (2005)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length