Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial

• Product Name Alternative:

  CD_antigen: CD242

• Abbreviation:

  Recombinant Mouse Icam4 protein, partial

• Gene Name:

  Icam4

• UniProt:

  Q9ERM2

• Expression Region:

  23-231aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

• Molecular Weight:

  39.1 kDa

• References & Citations:

  "Novel secreted isoform of adhesion molecule ICAM-4: potential regulator of membrane-associated ICAM-4 interactions."Lee G., Spring F.A., Parsons S.F., Mankelow T.J., Peters L.L., Koury M.J., Mohandas N., Anstee D.J., Chasis J.A.Blood 101:1790-1797 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Extracellular Domain