KIR2DL4 Blocking Peptide

• Catalog number
  33R-9831
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Immunology
• Tag Conjugate
  VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  KIR2DL4  
• Gene symbol
  KIR2DL4
• Short name
  KIR2DL4 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  killer cellular immunoglobulin-like receptor, two domains, large cytoplasmic tail, 4 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, CD158D and G9P and KIR-103AS and KIR103 and KIR103AS, KIR2DL4 and IDBG-69383 and ENSG00000189013 and 3805, protein binding, Plasma membranes

Gene info

• Identity
  HGNC:6332
• Gene
  KIR2DL4
• Long gene name
  killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
• Synonyms gene name
  • killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
• Synonyms
  • 103AS
  • 15.212
  • CD158D
• GenBank acession
  • X97229
• Locus
  19q13.42
• Discovery year
  1997-11-14
• Entrez gene record
  3805
• Pubmed identfication
  • 8946682
• RefSeq identity
  • NM_002255
• Classification
  • CD molecules
  • Killer cell immunoglobulin like receptors
• VEGA ID
  OTTHUMG00000065880
• Locus Specific Databases
  • IPD-KIR Database

MeSH Data

• Name
  Electrophoresis, Gel, Two-Dimensional
• Concept
  Scope note: Electrophoresis in which a second perpendicular electrophoretic transport is performed on the separate components resulting from the first electrophoresis. This technique is usually performed on polyacrylamide gels.
• Tree numbers
  • E05.196.401.250
  • E05.301.300.230
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products