Rabbit KIR2DL4 antibody

• Catalog number
  70R-2365
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
• Specificity
  KIR2DL4 antibody was raised against the middle region of KIR2DL4
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIR2DL4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  KIR2DL4  
• Gene symbol
  KIR2DL4
• Short name
  Rabbit KIR2DL4 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal KIR2DL4 antibody raised against the middle region of KIR2DL4
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, CD158D and G9P and KIR-103AS and KIR103 and KIR103AS, KIR2DL4 and IDBG-69383 and ENSG00000189013 and 3805, protein binding, Plasma membranes

Gene info

• Identity
  HGNC:6332
• Gene
  KIR2DL4
• Long gene name
  killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
• Synonyms gene name
  • killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
• Synonyms
  • 103AS
  • 15.212
  • CD158D
• GenBank acession
  • X97229
• Locus
  19q13.42
• Discovery year
  1997-11-14
• Entrez gene record
  3805
• Pubmed identfication
  • 8946682
• RefSeq identity
  • NM_002255
• Classification
  • CD molecules
  • Killer cell immunoglobulin like receptors
• VEGA ID
  OTTHUMG00000065880
• Locus Specific Databases
  • IPD-KIR Database

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products