Rabbit KIR2DL4 antibody
-
Catalog number70R-2365
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenKIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
-
SpecificityKIR2DL4 antibody was raised against the middle region of KIR2DL4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIR2DL4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolKIR2DL4
-
Short nameRabbit KIR2DL4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal KIR2DL4 antibody raised against the middle region of KIR2DL4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetkiller cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, CD158D and G9P and KIR-103AS and KIR103 and KIR103AS, KIR2DL4 and IDBG-69383 and ENSG00000189013 and 3805, protein binding, Plasma membranes
-
Gene info
-
Identity
-
Gene
-
Long gene namekiller cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
-
Synonyms gene name
- killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-11-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- Killer cell immunoglobulin like receptors
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data