Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1/TIMP1

  • Catalog number
    CM11-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene encoding Cys25-Arg205 is expressed.
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
  • Estimated molecular weight
    20,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P12032
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Additional description
    6
  • Gene target
  • Gene symbol
    TIMP1
  • Short name
    Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1/TIMP1
  • Technique
    Recombinant, tissue, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture. tissues
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse TIMP-1
  • Alternative technique
    rec, tissues, murine
  • Tissue
    tissue
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 1
  • Synonyms gene
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor)
  • Synonyms
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee