Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1/TIMP1

• Catalog number
  CM11-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene encoding Cys25-Arg205 is expressed.
• Species reactivity
  Mouse
• Origin
  Human Cells
• Peptide sequence
  CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
• Estimated molecular weight
  20,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P12032
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants
• Additional description
  6

• Gene target
  Tissue   Inhibitors   Metalloproteinases   1/TIMP1  
• Gene symbol
  TIMP1
• Short name
  Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1/TIMP1
• Technique
  Recombinant, tissue, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture. tissues
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse TIMP-1
• Alternative technique
  rec, tissues, murine
• Tissue
  tissue

Gene info

• Identity
  HGNC:11820
• Gene
  TIMP1
• Long gene name
  TIMP metallopeptidase inhibitor 1
• Synonyms gene
  • TIMP
  • CLGI
• Synonyms gene name
  • tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor)
• Synonyms
  • EPO
• Locus
  Xp11.3
• Discovery year
  1986-01-01
• Entrez gene record
  7076
• RefSeq identity
  • NM_003254
• Classification
  • Tissue inhibitor of metallopeptidases
• VEGA ID
  OTTHUMG00000021447
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products