Recombinant Human Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)

  • Catalog number
    C459-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human Tissue Inhibitor of Metalloproteinases 2 is produced by our Mammalian expression system and the target gene encoding Cys27-Pro220 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPVDHHHHHH
  • Estimated molecular weight
    22,79 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P16035
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional description
    Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme. 6
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TIMP2, TIMP1, MIR7-2, MIR329-2, MIR512-2, MIR521-2, MIR1289-2, MIR509-2, KRTAP13-2, RNU6-2
  • Short name
    Recombinant Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)
  • Technique
    Recombinant, tissue, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture. tissues
  • Species
    Human, Humans
  • Alternative name
    Human TIMP-2(C-6His)
  • Alternative technique
    rec, tissues
  • Tissue
    tissue
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 2
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 2
  • Synonyms
  • Locus
  • Discovery year
    1992-06-18
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 1
  • Synonyms gene
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor)
  • Synonyms
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The technique of placing cells or tissue in a supporting medium so that thin sections can be cut using a microtome. The medium can be paraffin wax (PARAFFIN EMBEDDING) or plastics (PLASTIC EMBEDDING) such as epoxy resins.
  • Tree numbers
    • E01.370.225.500.620.720
    • E01.370.225.750.600.720
    • E05.200.500.620.720
    • E05.200.750.600.720
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee