ATP2A2 Antibody

• Catalog number
  R30156
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  ATP2A2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  The stated application concentrations are suggested starting amounts. Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
• Intented use
  This ATP2A2 antibodyis to be used only for research purposes and not for diagnostics..
• Gene ID
  488
• Purity
  Antigen affinity
• Description
  SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.
• Immunogen
  An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.
• Storage
  After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ATP2A2  
• Gene symbol
  ATP2A2
• Short name
  Anti-ATP2A2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to ATP2A2
• Alternative technique
  antibodies
• Alternative to gene target
  ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, ATP2B and DAR and DD and SERCA2, ATP2A2 and IDBG-56943 and ENSG00000174437 and 488, calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential, Plasma membranes, Atp2a2 and IDBG-198239 and ENSMUSG00000029467 and 11938, ATP2A2 and IDBG-633099 and ENSBTAG00000001398 and 540568

Gene info

• Identity
  HGNC:812
• Gene
  ATP2A2
• Long gene name
  ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
• Synonyms gene
  • ATP2B
  • DAR
• Synonyms gene name
  • ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
• Synonyms
  • SERCA2
• Synonyms name
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  • calcium pump 2
• Locus
  12q24.11
• Discovery year
  1990-09-10
• Entrez gene record
  488
• Pubmed identfication
  • 10080178
• RefSeq identity
  • NM_001681
• Classification
  • ATPases Ca2+ transporting
• VEGA ID
  OTTHUMG00000169327

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products