ATP2A2 antibody

• Catalog number
  70R-6108
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Proteases, Inhibitors, & Enzymes
• Type of Immunogen
  ATP2A2 antibodies were raised using the C terminal of ATP2A2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV
• Raised in
  Rabbit
• Specificity
  ATP2A2 antibody was raised against the C terminal of ATP2A2
• Cross Reactivity
  Human,Mouse,Rat,Dog,Drosophila
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2A2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  ATP2A2 Blocking Peptide, catalog no. 33R-9709, is also available for use as a blocking control in assays to test for specificity of this ATP2A2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against ATP2A2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ATP2A2  
• Gene symbol
  ATP2A2
• Short name
  ATP2A2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ATP2A2 antibody raised against the C terminal of ATP2A2
• Alternative technique
  antibodies
• Alternative to gene target
  ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, ATP2B and DAR and DD and SERCA2, ATP2A2 and IDBG-56943 and ENSG00000174437 and 488, calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential, Plasma membranes, Atp2a2 and IDBG-198239 and ENSMUSG00000029467 and 11938, ATP2A2 and IDBG-633099 and ENSBTAG00000001398 and 540568

Gene info

• Identity
  HGNC:812
• Gene
  ATP2A2
• Long gene name
  ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
• Synonyms gene
  • ATP2B
  • DAR
• Synonyms gene name
  • ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
• Synonyms
  • SERCA2
• Synonyms name
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  • calcium pump 2
• Locus
  12q24.11
• Discovery year
  1990-09-10
• Entrez gene record
  488
• Pubmed identfication
  • 10080178
• RefSeq identity
  • NM_001681
• Classification
  • ATPases Ca2+ transporting
• VEGA ID
  OTTHUMG00000169327

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products