Rabbit ATP2A2 antibody
-
Catalog number70R-6108
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenATP2A2 antibody was raised using the C terminal of ATP2A2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV
-
SpecificityATP2A2 antibody was raised against the C terminal of ATP2A2
-
Cross ReactivityHuman,Mouse,Rat,Dog,Drosophila
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2A2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolATP2A2
-
Short nameRabbit ATP2A2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ATP2A2 antibody raised against the C terminal of ATP2A2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATPase, Ca++ transporting, cardiac muscle, slow twitch 2, ATP2B and DAR and DD and SERCA2, ATP2A2 and IDBG-56943 and ENSG00000174437 and 488, calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential, Plasma membranes, Atp2a2 and IDBG-198239 and ENSMUSG00000029467 and 11938, ATP2A2 and IDBG-633099 and ENSBTAG00000001398 and 540568
-
Gene info
-
Identity
-
Gene
-
Long gene nameATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
-
Synonyms gene
-
Synonyms gene name
- ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1990-09-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATPases Ca2+ transporting
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data