TRAF7 antibody

• Catalog number
  70R-5931
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  TRAF7 antibodies were raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
• Raised in
  Rabbit
• Specificity
  TRAF7 antibody was raised against the N terminal of TRAF7
• Cross Reactivity
  Human,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAF7 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  TRAF7 Blocking Peptide, catalog no. 33R-3462, is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody
• Additional Information
  This is a rabbit polyclonal antibody against TRAF7, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  TRAF7  
• Gene symbol
  TRAF7
• Short name
  TRAF7 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal TRAF7 antibody raised against the N terminal of TRAF7
• Alternative technique
  antibodies
• Alternative to gene target
  TNF receptor-associated factor 7, E3 ubiquitin protein ligase, TRAF7 and IDBG-10062 and ENSG00000131653 and 84231, ligase activity, multiple, Traf7 and IDBG-147098 and ENSMUSG00000052752 and 224619, TRAF7 and IDBG-635250 and ENSBTAG00000019073 and 511692

Gene info

• Identity
  HGNC:20456
• Gene
  TRAF7
• Long gene name
  TNF receptor associated factor 7
• Synonyms gene
  • RFWD1
• Synonyms gene name
  • ring finger and WD repeat domain 1
  • TNF receptor-associated factor 7, E3 ubiquitin protein ligase
• Synonyms
  • RNF119
  • DKFZp586I021
  • MGC7807
• GenBank acession
  • AL136921
• Locus
  16p13.3
• Discovery year
  2003-02-14
• Entrez gene record
  84231
• Pubmed identfication
  • 11230166
  • 15001576
• RefSeq identity
  • NM_032271
• Classification
  • Ring finger proteins
  • TNF receptor associated factors
  • WD repeat domain containing
• VEGA ID
  OTTHUMG00000128826

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products