Rabbit TRAF7 antibody
#
-
Catalog number70R-5931
-
Price:
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenTRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
-
SpecificityTRAF7 antibody was raised against the N terminal of TRAF7
-
Cross ReactivityHuman,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAF7 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTRAF7
-
Short nameRabbit TRAF7 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TRAF7 antibody raised against the N terminal of TRAF7
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetTNF receptor-associated factor 7, E3 ubiquitin protein ligase, TRAF7 and IDBG-10062 and ENSG00000131653 and 84231, ligase activity, multiple, Traf7 and IDBG-147098 and ENSMUSG00000052752 and 224619, TRAF7 and IDBG-635250 and ENSBTAG00000019073 and 511692
-
Gene info
-
Identity
-
Gene
-
Long gene nameTNF receptor associated factor 7
-
Synonyms gene
-
Synonyms gene name
- ring finger and WD repeat domain 1
- TNF receptor-associated factor 7, E3 ubiquitin protein ligase
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-02-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ring finger proteins
- TNF receptor associated factors
- WD repeat domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data