Rabbit TRAF7 antibody

#

• Catalog number
  70R-5931
• Price:

  Please ask

  Ask for price
• Size
  50 ug

# #

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
• Specificity
  TRAF7 antibody was raised against the N terminal of TRAF7
• Cross Reactivity
  Human,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAF7 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

#

• Gene target
  TRAF7  
• Gene symbol
  TRAF7
• Short name
  Rabbit TRAF7 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal TRAF7 antibody raised against the N terminal of TRAF7
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  TNF receptor-associated factor 7, E3 ubiquitin protein ligase, TRAF7 and IDBG-10062 and ENSG00000131653 and 84231, ligase activity, multiple, Traf7 and IDBG-147098 and ENSMUSG00000052752 and 224619, TRAF7 and IDBG-635250 and ENSBTAG00000019073 and 511692

Gene info

• Identity
  HGNC:20456
• Gene
  TRAF7
• Long gene name
  TNF receptor associated factor 7
• Synonyms gene
  • RFWD1
• Synonyms gene name
  • ring finger and WD repeat domain 1
  • TNF receptor-associated factor 7, E3 ubiquitin protein ligase
• Synonyms
  • RNF119
  • DKFZp586I021
  • MGC7807
• GenBank acession
  • AL136921
• Locus
  16p13.3
• Discovery year
  2003-02-14
• Entrez gene record
  84231
• Pubmed identfication
  • 11230166
  • 15001576
• RefSeq identity
  • NM_032271
• Classification
  • Ring finger proteins
  • TNF receptor associated factors
  • WD repeat domain containing
• VEGA ID
  OTTHUMG00000128826

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products