Rabbit RAB5A antibody
-
Catalog number70R-5813
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenRAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
-
SpecificityRAB5A antibody was raised against the middle region of RAB5A
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB5A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRAB5A
-
Short nameRabbit RAB5A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RAB5A antibody raised against the middle region of RAB5A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRAB5A, member RAS oncogene family, RAB5, RAB5A and IDBG-21702 and ENSG00000144566 and 5868, GDP-dissociation inhibitor binding, nuclei, Rab5a and IDBG-190768 and ENSMUSG00000017831 and 271457, BT.24043 and IDBG-631304 and ENSBTAG00000046385 and 539764
-
Gene info
-
Identity
-
Gene
-
Long gene nameRAB5A, member RAS oncogene family
-
Synonyms gene
-
Synonyms name
-
Locus
-
Discovery year1990-01-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RAB, member RAS oncogene GTPases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data