gentaur logogentaur logo
x

RAB5A antibody

  • Catalog number
    70R-5861
  • Product name
    RAB5A antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    RAB5A antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cancer
  • Type of Immunogen
    RAB5A antibodies were raised using the middle region of RAB5A corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS
  • Raised in
    Rabbit
  • Specificity
    RAB5A antibody was raised against the middle region of RAB5A
  • Cross Reactivity
    Human,Mouse,Rat,Dog
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB5A antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    RAB5A Blocking Peptide, catalog no. 33R-8417, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody
  • Additional Information
    This is a rabbit polyclonal antibody against RAB5A, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "RAB5A, member RAS oncogene family", "RAB5", "RAB5A and IDBG-21702 and ENSG00000144566 and 5868", "GDP-dissociation inhibitor binding", "nuclei", "Rab5a and IDBG-190768 and ENSMUSG00000017831 and 271457", "BT.24043 and IDBG-631304 and ENSBTAG00000046385 and 539764" ]
  • Gene target
    RAB5A
    • Gene info
  • Gene symbol
    RAB5A
  • Short name
    RAB5A antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies