Rabbit IGSF1 antibody

  • Catalog number
    70R-6152
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Immunology
  • Immunogen
    IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD
  • Specificity
    IGSF1 antibody was raised against the N terminal of IGSF1
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGSF1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    IGSF1  
  • Gene symbol
    IGSF1
  • Short name
    Rabbit IGSF1 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal IGSF1 antibody raised against the N terminal of IGSF1
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    immunoglobulin superfamily, member 1, CHTE and IGCD1 and IGDC1 and INHBP and p120 and PGSF2, IGSF1 and IDBG-86329 and ENSG00000147255 and 3547, inhibin binding, Extracellular, Igsf1 and IDBG-144491 and ENSMUSG00000031111 and 209268, IGSF1 and IDBG-630834 and ENSBTAG00000046476 and 100125775
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee