Rabbit IGSF1 antibody

• Catalog number
  70R-6035
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC
• Specificity
  IGSF1 antibody was raised against the middle region of IGSF1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGSF1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  IGSF1  
• Gene symbol
  IGSF1
• Short name
  Rabbit IGSF1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal IGSF1 antibody raised against the middle region of IGSF1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  immunoglobulin superfamily, member 1, CHTE and IGCD1 and IGDC1 and INHBP and p120 and PGSF2, IGSF1 and IDBG-86329 and ENSG00000147255 and 3547, inhibin binding, Extracellular, Igsf1 and IDBG-144491 and ENSMUSG00000031111 and 209268, IGSF1 and IDBG-630834 and ENSBTAG00000046476 and 100125775

Gene info

• Identity
  HGNC:5948
• Gene
  IGSF1
• Long gene name
  immunoglobulin superfamily member 1
• Synonyms gene name
  • immunoglobulin superfamily, member 1
• Synonyms
  • KIAA0364
  • IGDC1
  • IGCD1
  • INHBP
  • MGC75490
  • PGSF2
• GenBank acession
  • AF034198
• Locus
  Xq25
• Discovery year
  1997-10-27
• Entrez gene record
  3547
• Pubmed identfication
  • 9521868
  • 9729118
• Classification
  • Immunoglobulin like domain containing
• VEGA ID
  OTTHUMG00000022406
• Locus Specific Databases
  • Global Variome shared LOVD
  • LRG_840

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products