Rabbit IGSF1 antibody
-
Catalog number70R-1671
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenIGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
-
SpecificityIGSF1 antibody was raised against the N terminal of IGSF1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IGSF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIGSF1
-
Short nameRabbit IGSF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IGSF1 antibody raised against the N terminal of IGSF1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetimmunoglobulin superfamily, member 1, CHTE and IGCD1 and IGDC1 and INHBP and p120 and PGSF2, IGSF1 and IDBG-86329 and ENSG00000147255 and 3547, inhibin binding, Extracellular, Igsf1 and IDBG-144491 and ENSMUSG00000031111 and 209268, IGSF1 and IDBG-630834 and ENSBTAG00000046476 and 100125775
-
Gene info
-
Identity
-
Gene
-
Long gene nameimmunoglobulin superfamily member 1
-
Synonyms gene name
- immunoglobulin superfamily, member 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-10-27
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Immunoglobulin like domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data