Rabbit FRK antibody
-
Catalog number70R-5665
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFRK antibody was raised using the middle region of FRK corresponding to a region with amino acids DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPG
-
SpecificityFRK antibody was raised against the middle region of FRK
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FRK antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFRK
-
Short nameRabbit FRK antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FRK antibody raised against the middle region of FRK
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetfyn-related kinase, GTK and PTK5 and RAK, FRK and IDBG-95607 and ENSG00000111816 and 2444, transferase activity, nuclei, Frk and IDBG-143883 and ENSMUSG00000019779 and 14302, FRK and IDBG-631180 and ENSBTAG00000020018 and 509227
-
Gene info
-
Identity
-
Gene
-
Long gene namefyn related Src family tyrosine kinase
-
Synonyms gene
-
Synonyms gene name
- PTK5 protein tyrosine kinase 5
- fyn-related kinase
- fyn-related Src family tyrosine kinase
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1995-02-08
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Src family tyrosine kinases
- SH2 domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data