Rabbit FRK antibody

• Catalog number
  70R-5664
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH
• Specificity
  FRK antibody was raised against the N terminal of FRK
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FRK antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  FRK  
• Gene symbol
  FRK
• Short name
  Rabbit FRK antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal FRK antibody raised against the N terminal of FRK
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  fyn-related kinase, GTK and PTK5 and RAK, FRK and IDBG-95607 and ENSG00000111816 and 2444, transferase activity, nuclei, Frk and IDBG-143883 and ENSMUSG00000019779 and 14302, FRK and IDBG-631180 and ENSBTAG00000020018 and 509227

Gene info

• Identity
  HGNC:3955
• Gene
  FRK
• Long gene name
  fyn related Src family tyrosine kinase
• Synonyms gene
  • PTK5
• Synonyms gene name
  • PTK5 protein tyrosine kinase 5
  • fyn-related kinase
  • fyn-related Src family tyrosine kinase
• Synonyms
  • RAK
  • GTK
• GenBank acession
  • U00803
• Locus
  6q22.1
• Discovery year
  1995-02-08
• Entrez gene record
  2444
• Pubmed identfication
  • 7510261
• RefSeq identity
  • NM_002031
• Classification
  • Src family tyrosine kinases
  • SH2 domain containing
• VEGA ID
  OTTHUMG00000015424

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products