FRK antibody

• Catalog number
  70R-5665
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  FRK antibodies were raised using the middle region of FRK corresponding to a region with amino acids DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPG
• Raised in
  Rabbit
• Specificity
  FRK antibody was raised against the middle region of FRK
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FRK antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  FRK Blocking Peptide, catalog no. 33R-2066, is also available for use as a blocking control in assays to test for specificity of this FRK antibody
• Additional Information
  This is a rabbit polyclonal antibody against FRK, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FRK  
• Gene symbol
  FRK
• Short name
  FRK antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal FRK antibody raised against the middle region of FRK
• Alternative technique
  antibodies
• Alternative to gene target
  fyn-related kinase, GTK and PTK5 and RAK, FRK and IDBG-95607 and ENSG00000111816 and 2444, transferase activity, nuclei, Frk and IDBG-143883 and ENSMUSG00000019779 and 14302, FRK and IDBG-631180 and ENSBTAG00000020018 and 509227

Gene info

• Identity
  HGNC:3955
• Gene
  FRK
• Long gene name
  fyn related Src family tyrosine kinase
• Synonyms gene
  • PTK5
• Synonyms gene name
  • PTK5 protein tyrosine kinase 5
  • fyn-related kinase
  • fyn-related Src family tyrosine kinase
• Synonyms
  • RAK
  • GTK
• GenBank acession
  • U00803
• Locus
  6q22.1
• Discovery year
  1995-02-08
• Entrez gene record
  2444
• Pubmed identfication
  • 7510261
• RefSeq identity
  • NM_002031
• Classification
  • Src family tyrosine kinases
  • SH2 domain containing
• VEGA ID
  OTTHUMG00000015424

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products