Rabbit DDX42 antibody
-
Catalog number70R-4789
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenDDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX42 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDDX42
-
Short nameRabbit DDX42 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DDX42 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetDEAD (Asp-Glu-Ala-Asp) box polypeptide 42, DDX42P and RHELP and RNAHP and SF3b125 and SF3B8, DDX42 and IDBG-63647 and ENSG00000198231 and 11325, poly(A) RNA binding, nuclei, Ddx42 and IDBG-213407 and ENSMUSG00000020705 and 72047, DDX42 and IDBG-641673 and ENSBTAG00000021058 and 100140430
-
Gene info
-
Identity
-
Gene
-
Long gene nameDEAD-box helicase 42
-
Synonyms gene name
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 42
- DEAD (Asp-Glu-Ala-Asp) box helicase 42
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2003-06-13
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- DEAD-box helicases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data