Rabbit CD40 antibody

  • Catalog number
    70R-6008
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Immunology
  • Immunogen
    CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
  • Specificity
    CD40 antibody was raised against the N terminal of CD40
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD40 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    CD40  
  • Gene symbol
    CD40
  • Short name
    Rabbit CD40 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal CD40 antibody raised against the N terminal of CD40
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    CD40 molecule, TNF receptor superfamily member 5, Bp50 and CDW40 and p50 and TNFRSF5, CD40 and IDBG-78904 and ENSG00000101017 and 958, ubiquitin protein ligase binding, Extracellular, Cd40 and IDBG-212533 and ENSMUSG00000017652 and 21939, BT.42498 and IDBG-643036 and ENSBTAG00000020736 and 286849
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The number of CD4-POSITIVE T-LYMPHOCYTES per unit volume of BLOOD. Determination requires the use of a fluorescence-activated flow cytometer.
  • Tree numbers
    • E01.370.225.500.195.107.595.500.150
    • E01.370.225.625.107.595.500.150
    • E05.200.500.195.107.595.500.150
    • E05.200.625.107.595.500.150
    • E05.242.195.107.595.500.150
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee