CD40 antibody

• Catalog number
  70R-6008
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Immunology
• Type of Immunogen
  CD40 antibodies were raised using the N terminal of CD40 corresponding to a region with amino acids WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
• Raised in
  Rabbit
• Specificity
  CD40 antibody was raised against the N terminal of CD40
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD40 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 0.25 ug/ml
• Assay Information
  CD40 Blocking Peptide, catalog no. 33R-9985, is also available for use as a blocking control in assays to test for specificity of this CD40 antibody
• Additional Information
  This is a rabbit polyclonal antibody against CD40, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  CD40  
• Gene symbol
  CD40
• Short name
  CD40 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal CD40 antibody raised against the N terminal of CD40
• Alternative technique
  antibodies
• Alternative to gene target
  CD40 molecule, TNF receptor superfamily member 5, Bp50 and CDW40 and p50 and TNFRSF5, CD40 and IDBG-78904 and ENSG00000101017 and 958, ubiquitin protein ligase binding, Extracellular, Cd40 and IDBG-212533 and ENSMUSG00000017652 and 21939, BT.42498 and IDBG-643036 and ENSBTAG00000020736 and 286849

Gene info

• Identity
  HGNC:11919
• Gene
  CD40
• Long gene name
  CD40 molecule
• Synonyms gene
  • TNFRSF5
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 5
  • CD40 molecule, TNF receptor superfamily member 5
• Synonyms
  • p50
  • Bp50
• GenBank acession
  • X60592
• Locus
  20q13.12
• Discovery year
  1993-08-27
• Entrez gene record
  958
• Pubmed identfication
  • 7687385
  • 2998589
• RefSeq identity
  • NM_001250
• Classification
  • CD molecules
  • Tumor necrosis factor receptor superfamily
• VEGA ID
  OTTHUMG00000033053
• Locus Specific Databases
  • CD40base: Mutation registry for CD40 deficiency (previously known as TNFRSF5base)
  • LRG_40

Similar products