Rabbit CD40 antibody
-
Catalog number70R-5925
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenCD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
-
SpecificityCD40 antibody was raised against the N terminal of CD40
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD40 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCD40
-
Short nameRabbit CD40 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CD40 antibody raised against the N terminal of CD40
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetCD40 molecule, TNF receptor superfamily member 5, Bp50 and CDW40 and p50 and TNFRSF5, CD40 and IDBG-78904 and ENSG00000101017 and 958, ubiquitin protein ligase binding, Extracellular, Cd40 and IDBG-212533 and ENSMUSG00000017652 and 21939, BT.42498 and IDBG-643036 and ENSBTAG00000020736 and 286849
-
Gene info
-
Identity
-
Gene
-
Long gene nameCD40 molecule
-
Synonyms gene
-
Synonyms gene name
- tumor necrosis factor receptor superfamily, member 5
- CD40 molecule, TNF receptor superfamily member 5
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-08-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- Tumor necrosis factor receptor superfamily
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data