PPIL2 Blocking Peptide

• Catalog number
  33R-6143
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Protein Modification & Stress Response
• Residues
  MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PPIL2  
• Gene symbol
  PPIL2
• Short name
  PPIL2 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of PPIL2 antibody, catalog no. 70R-2369
• Alternative technique
  control, peptides
• Alternative to gene target
  peptidylprolyl isomerase (cyclophilin)-like 2, CYC4 and Cyp-60 and CYP60 and hCyP-60 and UBOX7, PPIL2 and IDBG-2106 and ENSG00000100023 and 23759, ubiquitin-ubiquitin ligase activity, nuclei, Ppil2 and IDBG-137979 and ENSMUSG00000022771 and 66053, PPIL2 and IDBG-637559 and ENSBTAG00000021121 and 511467

Gene info

• Identity
  HGNC:9261
• Gene
  PPIL2
• Long gene name
  peptidylprolyl isomerase like 2
• Synonyms gene name
  • peptidylprolyl isomerase (cyclophilin)-like 2
• Synonyms
  • UBOX7
  • CYC4
  • Cyp-60
• Synonyms name
  • U-box domain containing 7
  • peptidyl-prolyl cis-trans isomerase-like 2
• Locus
  22q11.21
• Discovery year
  1999-10-29
• Entrez gene record
  23759
• Pubmed identfication
  • 10591208
• Classification
  • Spliceosomal Bact complex
  • U-box domain containing
  • Cyclophilin peptidylprolyl isomerases
• VEGA ID
  OTTHUMG00000191763

Similar products