Rabbit PPIL2 antibody

• Catalog number
  70R-2369
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Protein Modification & Stress Response
• Immunogen
  PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP
• Specificity
  NA
• Cross Reactivity
  Human, Mouse, Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPIL2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PPIL2  
• Gene symbol
  PPIL2
• Short name
  Rabbit PPIL2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PPIL2 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  peptidylprolyl isomerase (cyclophilin)-like 2, CYC4 and Cyp-60 and CYP60 and hCyP-60 and UBOX7, PPIL2 and IDBG-2106 and ENSG00000100023 and 23759, ubiquitin-ubiquitin ligase activity, nuclei, Ppil2 and IDBG-137979 and ENSMUSG00000022771 and 66053, PPIL2 and IDBG-637559 and ENSBTAG00000021121 and 511467

Gene info

• Identity
  HGNC:9261
• Gene
  PPIL2
• Long gene name
  peptidylprolyl isomerase like 2
• Synonyms gene name
  • peptidylprolyl isomerase (cyclophilin)-like 2
• Synonyms
  • UBOX7
  • CYC4
  • Cyp-60
• Synonyms name
  • U-box domain containing 7
  • peptidyl-prolyl cis-trans isomerase-like 2
• Locus
  22q11.21
• Discovery year
  1999-10-29
• Entrez gene record
  23759
• Pubmed identfication
  • 10591208
• Classification
  • Spliceosomal Bact complex
  • U-box domain containing
  • Cyclophilin peptidylprolyl isomerases
• VEGA ID
  OTTHUMG00000191763

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products