Integrin alpha 3B antibody

• Catalog number
  10R-8072
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Monoclonal Antibodies
• Area of research
  Signal Transduction
• Type of Immunogen
  Integrin alpha 3B antibodies were raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin ..
• Raised in
  Mouse
• Specificity
  Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart
• Cross Reactivity
  Human
• Isotypes
  IgG1
• Clone
  54B3
• Form Buffer
  Provided in PBS containing 0.09% NaN3
• Tested for
  IHC; IHC-F; WB
• Usage Recommendations
  IHC: 1:25-1:200, WB: 1:100-1:1000
• URL
• More info
• Description
  The Integrin alpha 3B antibody is a α- or alpha protein sometimes glycoprotein present in blood.
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Integrin   alpha  
• Short name
  Integrin alpha 3B antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Mouse monoclonal Integrin alpha 3B antibody
• Alternative technique
  antibodies

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products