Integrin alpha 3A antibody

  • Catalog number
    10R-8071
  • Price
    Please ask
  • Size
    100 µg
  • Category
    Primary Antibody
  • Antibody Subtype
    Monoclonal Antibodies
  • Area of research
    Signal Transduction
  • Type of Immunogen
    Integrin alpha 3A antibodies were raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin ..
  • Raised in
    Mouse
  • Specificity
    Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A
  • Cross Reactivity
    Human
  • Isotypes
    IgG2a
  • Clone
    158A3
  • Form Buffer
    Provided in PBS containing 0.09% NaN3
  • Tested for
    IHC; IHC-F; WB
  • Usage Recommendations
    IHC: 1:100-1:200, WB: 1:100-1:1000
  • URL
  • Description
    The Integrin alpha 3A antibody is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    Integrin   alpha  
  • Short name
    Integrin alpha 3A antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Mouse monoclonal Integrin alpha 3A antibody
  • Alternative technique
    antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee