-
Target antigen
Leptin Receptor
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
IHC-P,ELISA
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eight amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Leptin Receptor Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Leptin Receptor Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
-
Related articles
1. "Entrez Gene: LEPR leptin receptor". 2. Tartaglia LA, Dembski M, Weng X, Deng N, Culpepper J, Devos R, Richards GJ, Campfield LA, Clark FT, Deeds J, Muir C, Sanker S, Moriarty A, Moore KJ, Smutko JS, Mays GG, Wool EA, Monroe CA, Tepper RI (Feb 1996). "Identification and expression cloning of a leptin receptor, OB-R". Cell. 83 (7): 1263–71. 3. Winick JD, Stoffel M, Friedman JM (Feb 1997). "Identification of microsatellite markers linked to the human leptin receptor gene on chromosome 1".Genomics. 36 (1): 221–2.
-
Gene Name
LEPR
-
Protein Name
Leptin receptor
-
Gene Full Name
leptin receptor
-
Synonyms
CD295 | DB | OBR | Fa | Obr | HuB219 | LEP R | LEPR | LEP-R | LEPRD | LEPROT | Leptin receptor | OB R | OB receptor | OB-R | OBRGRP | OB-RGRP | P48357
-
Uniprot ID
P48357
-
Entrez GeneID
3953
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Gene
Human or mouse Leptin (from Greek λεπτός leptos, "thin") the "satiety hormone", is a hormone made by adipose cells that helps to regulate energy balance by inhibiting hunger. Leptin is opposed by the actions of the hormone ghrelin, the "hunger hormone". Both hormones act on receptors in the arcuate nucleus of the hypothalamus to regulate appetite to achieve energy homeostasis. ELISA kits and peptides and antibodies are available.
-
Description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps
