Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Interleukin 1a IL-1a

Recombinant Mouse Interleukin 1a IL-1a is available 4 times from Novo labs

C041-50 | Recombinant Mouse Interleukin-1a/IL-1a size: 50 ug | 589.04 USD

Loading

C041-1000 | Recombinant Mouse Interleukin-1a/IL-1a size: 1 mg | 1,828.76 USD

Catalog number C041-1000
Supplier novo
Price 1,828.76 USD
Size 1 mg
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity 13765
Gene IL25
Long gene name interleukin 25
Synonyms gene
  • IL17E
Synonyms gene name
  • interleukin 17E
Synonyms
  • IL-25
  • IL-17E
GenBank acession
  • AF305200
Locus 14q11.2
Discovery year 2001-01-26
Pubmed identfication
  • 11058597
  • 11754819
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000028749
2. Gene info
Identity 5991
Gene IL1A
Long gene name interleukin 1 alpha
Synonyms gene
  • IL1
Synonyms
  • IL1F1
  • IL-1A
  • IL1-ALPHA
Synonyms name
  • preinterleukin 1 alpha
  • hematopoietin-1
  • pro-interleukin-1-alpha
GenBank acession
  • M28983
Locus 2q14.1
Discovery year 2001-06-22
Entrez gene record 3552
Pubmed identfication
  • 8188271
  • 2989698
RefSeq identity
  • NM_000575
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000131315
Product images
    #Mouse#.jpg

C041-500 | Recombinant Mouse Interleukin-1a/IL-1a size: 500 ug | 1,298.98 USD

Loading

C041-10 | Recombinant Mouse Interleukin-1a/IL-1a size: 10 ug | 240.60 USD

Loading
Description Recombinant Mouse Interleukin-1 alpha is produced by our E.coli expression system and the target gene encoding Ser115-Ser270 is expressed.
Species reactivity Mouse
Origin Escherichia coli
Peptide sequence SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Estimated molecular weight 18 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl, 200mM NaCl, pH 8.0.
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number P01582
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-1a/IL-1a
Short name Recombinant Mouse Interleukin-1a/IL-1a
Technique Recombinant, Mouse
Host mouse
Species Mouse
Alternative name Mouse IL-1 alpha/IL-1F1/IL-1a
Alternative technique rec
Similar products
ARHGEF3 Antibody Suppplier: Lifescience Market
Price: 519.12 USD
PFDN4 antibody - N-terminal region Suppplier: aviva
Price: 370.97 USD
RBL2 polyclonal antibody Suppplier: Bioworld
Price: 365.04 USD
Lamp Suppplier: Diasource
Price: 317.63 USD
Recombinant Mouse Interleukin 23 IL-23 Suppplier: novo
Price: 276.15 USD
Biphenyl-2-carboxylic Acid Suppplier: trca
Price: 248.89 USD
Recombinant Mouse Interleukin 1ß IL-1ß Suppplier: novo
Price: 240.60 USD
Recombinant Mouse Interleukin 6 IL-6 Suppplier: novo
Price: 240.60 USD
Recombinant Mouse Interleukin 10 IL-10 Suppplier: novo
Price: 240.60 USD
LGI4 Peptide Suppplier: MyBioSource
Price: 235.85 USD
Recombinant Mouse Interleukin 16 IL-16 Suppplier: novo
Price: 186.08 USD
Quinine, anhydrous Suppplier: Molekula
Price: 148.15 USD
Recombinant Mouse Interleukin 16 Suppplier: MyBioSource
Price: 5.93 USD
Human UBAP2 CRISPR Knock Out Cell Line Suppplier: ABM CrispR
Price: 6 899.05 USD
CCNF 3'UTR GFP Stable Cell Line Suppplier: ABM microrna
Price: 1 682.98 USD
Ask
Ajax processing
Close
Recombinant Mouse Interleukin-1a/IL-1a | Technique alternati
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Interleukin-1a/IL-1a
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee