Recombinant Mouse IL-1 beta

  • Catalog number
    RP0359M-005
  • Price
    Please ask
  • Size
    5 ug
  • Product Type
    Protein
  • Target
    IL-1 beta
  • Alias
    IL-1F2
  • MW
    17.4 kDa
  • Form
    Lyophilized
  • Storage
    -20 °C
  • Shipping
    Ambient
  • Entrez Gene ID
    16176
  • Protein Sequence
    VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)
  • Source
    Yeast
  • Gene
    The Interleukin-1 family (IL-1 family) is a group of 11 cytokines, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults. Rec. E. coli interleukin-1 for cell culture or antibody production.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    IL-1   beta  
  • Gene symbol
    IL1A, IL1B, IL1F10, IL36B, IL36A, IL19, IL17F, IL36G, IL25, IL22
  • Short name
    Recombinant Mouse IL-1 beta
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. kingfisherbiotech advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse Interleukin-1 b
  • Alternative technique
    rec, murine
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee