Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Interleukin 36a IL-36a

Recombinant Human Interleukin 36a IL-36a is available 4 times from Novo labs

C072-1000 | Recombinant Human Interleukin-36a/IL-36a size: 1 mg | 2,519.06 USD

Catalog number C072-1000
Supplier novo
Price 2,519.06 USD
Size 1 mg
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C072-10 | Recombinant Human Interleukin-36a/IL-36a size: 10 ug | 223.99 USD

Loading

C072-50 | Recombinant Human Interleukin-36a/IL-36a size: 50 ug | 548.39 USD

Loading

C072-500 | Recombinant Human Interleukin-36a/IL-36a size: 500 ug | 1,780.89 USD

Loading
Description Recombinant Human Interleukin-36 alpha is produced by our E.coli expression system and the target gene encoding Met1-Phe158 is expressed.
Species reactivity Human
Origin Escherichia coli
Peptide sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Estimated molecular weight 17,7 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number Q9UHA7
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-36a/IL-36a
Short name Recombinant Interleukin-36a/IL-36a
Technique Recombinant
Species Human
Alternative name recombinant H. sapiens Interleukin-36a/Interleukin-36a
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human Interleukin-36a/IL-36a size: 1 mg
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Interleukin-36a/IL-36a
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee