Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Interleukin 36a IL-36a

Recombinant Human Interleukin 36a IL-36a is available 4 times from Novo labs

C072-500 | Recombinant Human Interleukin-36a/IL-36a size: 500 ug | 1,909.85 USD

Loading

C072-1000 | Recombinant Human Interleukin-36a/IL-36a size: 1 mg | 2,701.47 USD

Catalog number C072-1000
Supplier novo
Price 2,701.47 USD
Size 1 mg
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity 13765
Gene IL25
Long gene name interleukin 25
Synonyms gene
  • IL17E
Synonyms gene name
  • interleukin 17E
Synonyms
  • IL-25
  • IL-17E
GenBank acession
  • AF305200
Locus 14q11.2
Discovery year 2001-01-26
Pubmed identfication
  • 11058597
  • 11754819
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000028749
Product images
    #Human#.jpg

C072-10 | Recombinant Human Interleukin-36a/IL-36a size: 10 ug | 240.21 USD

Loading

C072-50 | Recombinant Human Interleukin-36a/IL-36a size: 50 ug | 588.10 USD

Loading
Description Recombinant Human Interleukin-36 alpha is produced by our E.coli expression system and the target gene encoding Met1-Phe158 is expressed.
Species reactivity Human
Origin Escherichia coli
Peptide sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Estimated molecular weight 17,7 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number Q9UHA7
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-36a/IL-36a
Short name Recombinant Interleukin-36a/IL-36a
Technique Recombinant
Species Human
Alternative name Human IL-36 alpha/IL-1F6
Alternative technique rec
Similar products
CCL14 Antibody Suppplier: Affinity Biosciences
Price: 508.82 USD
MSH6 antibody Suppplier: SAB
Price: 507.64 USD
Rala Antibody - N-terminal region Suppplier: aviva
Price: 370.37 USD
MARCH9 Primary Antibody Suppplier: EnoGene
Price: 349.07 USD
anti-ZMIZ2 control peptide Antibody, 50 Вµg Suppplier: acr
Price: 333.69 USD
MITF phospho Ser180 Polyclonal Antibody Suppplier: Abbkine
Price: 331.32 USD
GYG1 Antibody Suppplier: Bioss Primary Unconjugated Antibodies
Price: 311.21 USD
PIC 256NA3SA (Zelfklevende polypropyleenplaat) Suppplier: Brady Benelux NL
Price: 300.56 USD
Nocturnin Blocking Peptide Suppplier: MyBioSource
Price: 268.61 USD
Recombinant PGL p HBAD biosynthesis Suppplier: MyBioSource
Price: 5.92 USD
Streptococcus gordonii 30S ribosomal protein S3 rpsC Suppplier: MBS Recombinant
Price: 1 961.91 USD
Rhodococcus opacus Ribonuclease Suppplier: MBS Recombinant
Price: 1 693.30 USD
Dog Neuronal apoptosis inhibitory protein ELISA kit Suppplier: BlueGen ELISAs
Price: 1 502.79 USD
Human HDAC5 Ab Antibody Suppplier: genways bulk
Price: 0.00 USD
Recombinant Cupriavidus pinatubonensis Lipid A Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Interleukin-36a/IL-36a | Technique alternative |
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Interleukin-36a/IL-36a
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee