Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

MMP 14 MT1 MMP domain Recombinant Protein

MMP 14 MT1 MMP domain Recombinant Protein is available 8 times from Biotez labs

30 100 102 | MMP 14 (MT1-MMP) catalytic domain (Recombinant Protein) size: 10 µg/ 50µl | 377.26 USD

Loading

30 100 103 | MMP 14 (MT1-MMP) catalytic domain (Recombinant Protein) size: 200 µg/ 1 ml | 5,553.55 USD

Loading

30 100 131 | MMP 14 (MT1-MMP) hemopexin domain, His-tagged (Recombinant Protein) size: 20 µg/ 100µl | 377.26 USD

Loading

30 100 133 | MMP 14 (MT1-MMP) hemopexin domain, His-tagged (Recombinant Protein) size: 200 µg/ 1 ml | 2,769.56 USD

Loading

30 100 122 | MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin domain, His-tagged (Recombinant Protein) size: 10 µg/ 50µl | 377.26 USD

Tested applications Investigation of MT1-MMP; Generation of active MT1-MMP for progelatinase A activation; Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
Peptide sequence SLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVTHHHHHH
Active form? No
Tag His-tagged
Contents 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2.
Protein purity > 80 %
Molecular weight 58 kDa
Abbreviation MMP14
Full name matrix metallopeptidase 14
Other desciption Recombinant soluble pro-MT1-MMP is produced as a periplasmic protein in E. coli. The protein contains prodomain, catalytic domain and hemopexin domain of MT1-MMP
Conjugation histidine
Source Recombinants or rec. proteins
Group recombinants
Gene targetMMP MT1-MMP prodomain catalytic domain hemopexin domain His-tagged Protein
Short name MMP 14 (MT1-MMP) prodomain, catalytic domain, hemopexin domain, His-tagged (Recombinant Protein)
Label his-tagged
Alternative name MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin domain, histidine-tagged (recombinant Protein)
1. Gene info
Identity7160
GeneMMP14
Synonyms gene name
  • matrix metalloproteinase 14 (membrane-inserted)
  • matrix metallopeptidase 14 (membrane-inserted)
Synonyms
Locus14q11.2
Discovery year1994-11-20
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000028704
2. Gene info
Identity7172
GeneMMP24
Synonyms gene name
  • matrix metalloproteinase 24 (membrane-inserted)
  • matrix metallopeptidase 24 (membrane-inserted)
Synonyms
GenBank acession
Discovery year1999-08-06
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000032330
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500

30 100 123 | MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin domain, His-tagged (Recombinant Protein) size: 200 µg/ 1 ml | 5,553.55 USD

Loading

30 100 112 | MMP 14 (MT1-MMP) prodomain, catalytic domain, His-tagged (Recombinant Protein) size: 10 µg/ 50µl | 377.26 USD

Loading

30 100 113 | MMP 14 (MT1-MMP) prodomain, catalytic domain, His-tagged (Recombinant Protein) size: 200 µg/ 1 ml | 5,553.55 USD

Loading
Protein type Recombinant
Protein subtype EC 3.4.24.80
Protein family Matrix Metalloproteinases, matrixins
Protein description MMP14 seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
Research area interests Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Signaling events mediated by focal adhesion kinase and Adhesion
Package form liquid
Other names Membrane-Type-1 Matrix Metalloproteinase
Available target modification No
Expression system E.coli
Product Subtype protein fragment
UniProt number P50281
Gene number 4323
Purification Mentioned in the data sheet
PubMed citations See the data sheet
Warnings For Research Use only.
Shipping conditions dry ice
Storage condition Store at -70°C
Technical datasheet Contact us to receive the datasheet
Technique Recombinant
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin
Filters
+32-(0)1-658-90-45 [email protected]
  • MMP
  • MT1-MMP
  • catalytic
  • domain
  • Protein
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee