MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin domain, His-tagged (Recombinant Protein)

#
  • Catalog number
    30 100 123
  • Price:

    Please ask

    Ask for price
  • Size
    200 µg/ 1 ml
# #
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.24.80
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Protein description
    MMP14 seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
  • Research area interests
    Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Signaling events mediated by focal adhesion kinase and Adhesion
  • Package form
    liquid
  • Tested applications
    Investigation of MT1-MMP; Generation of active MT1-MMP for progelatinase A activation; Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Other names
    Membrane-Type-1 Matrix Metalloproteinase
  • Peptide sequence
    SLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVTHHHHHH
  • Available target modification
    No
  • Expression system
    E.coli
  • Product Subtype
    protein fragment
  • Active form
    No
  • Tag
    His-tagged
  • Contents
    50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2.
  • Protein purity
    > 80 %
  • Molecular weight
    58 kDa
  • UniProt number
    P50281
  • Gene number
    4323
  • Abbreviation
    MMP14
  • Full name
    matrix metallopeptidase 14
  • Other desciption
    Recombinant soluble pro-MT1-MMP is produced as a periplasmic protein in E. coli. The protein contains prodomain, catalytic domain and hemopexin domain of MT1-MMP
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Conjugation
    histidine
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
  • Gene symbol
    MMP14, MMP24, MMP28, MMP17, MMP15, MMP25, MMP16, MT1H, MT1F, MT1E
  • Short name
    MMP 14 (MT1-MMP) prodomain, catalytic domain, hemopexin domain, His-tagged (Recombinant Protein)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    his-tagged
  • Species
    Homo sapiens
  • Alternative name
    MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin domain, histidine-tagged (Rec. Protein)
  • Alternative technique
    rec
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 17
  • Synonyms gene name
    • matrix metalloproteinase 17 (membrane-inserted)
    • matrix metallopeptidase 17 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 16
  • Synonyms gene
  • Synonyms gene name
    • matrix metalloproteinase 16 (membrane-inserted)
    • chromosome 8 open reading frame 57
    • matrix metallopeptidase 16 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee