Recombinant Feline IL-1 beta

  • Catalog number
    RP0098F-005
  • Price
    Please ask
  • Size
    5 ug
  • Product Type
    Protein
  • Target
    IL-1 beta
  • Alias
    IL-1F2
  • MW
    17.4 kDa
  • Form
    Lyophilized
  • Storage
    -20 °C
  • Shipping
    Ambient
  • Entrez Gene ID
    768274
  • Protein Sequence
    AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS
  • Source
    Yeast
  • Gene
    The Interleukin-1 family (IL-1 family) is a group of 11 cytokines, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults. Rec. E. coli interleukin-1 for cell culture or antibody production.
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    IL-1   beta  
  • Gene symbol
    IL1A, IL1B, IL1F10, IL36B, IL36A, IL19, IL17F, IL36G, IL25, IL22
  • Short name
    Recombinant Feline IL-1 beta
  • Technique
    Recombinant, Feline, felines, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. kingfisherbiotech advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Feline, Sometimes til 5% of an area felines have specific IgGs for the feline retroviral feLV infecting Felidae. Also distemper and leukemia virusses apear in cats and have their specific IgG antibodies that are very stable. All cats used for producing immunoglobulins are screened and tested virus negative. Cat seras have usually higher IgG tirters than dog serum. Feline range = 10 to 20 mg/ml IgGs.
  • Alternative name
    Rec. Feline Interleukin-1 b
  • Alternative technique
    rec, cats
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee